Lineage for d1cjya1 (1cjy A:13-141)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11283Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 11284Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins)
  6. 11285Protein Domain from cytosolic phospholipase A2 [49566] (1 species)
  7. 11286Species Human (Homo sapiens) [TaxId:9606] [49567] (3 PDB entries)
  8. 11288Domain d1cjya1: 1cjy A:13-141 [23178]
    Other proteins in same PDB: d1cjya2, d1cjyb2

Details for d1cjya1

PDB Entry: 1cjy (more details), 2.5 Å

PDB Description: human cytosolic phospholipase a2

SCOP Domain Sequences for d1cjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjya1 b.7.1.1 (A:13-141) Domain from cytosolic phospholipase A2 {Human (Homo sapiens)}
ehqyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwn
etfefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvl
emslevcsc

SCOP Domain Coordinates for d1cjya1:

Click to download the PDB-style file with coordinates for d1cjya1.
(The format of our PDB-style files is described here.)

Timeline for d1cjya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjya2