Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) |
Family b.44.2.0: automated matches [231768] (1 protein) not a true family |
Protein automated matches [231769] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [231770] (3 PDB entries) |
Domain d3a8ka2: 3a8k A:277-363 [231779] Other proteins in same PDB: d3a8ka1, d3a8kb1, d3a8kc1, d3a8kd1, d3a8ke_, d3a8kf_ automated match to d1vloa1 |
PDB Entry: 3a8k (more details), 1.95 Å
SCOPe Domain Sequences for d3a8ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8ka2 b.44.2.0 (A:277-363) automated matches {Escherichia coli K-12 [TaxId: 83333]} teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget aivqirnrempvkvtkpvfvrngkava
Timeline for d3a8ka2: