SCOPe 2.06: Domain d3a7na1: 3a7n A:1-227

Lineage for d3a7na1 (3a7n A:1-227)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.0: automated matches [193165] (1 protein)
   not a true family

6. Protein automated matches [193166] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries)

8. Domain d3a7na1: 3a7n A:1-227 [231764]
   Other proteins in same PDB: d3a7na2
   automated match to d3zoqa_
   protein/DNA complex; complexed with flc

Details for d3a7na1

PDB Entry: 3a7n, 1.95 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from Mycobacterium tuberculosis

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3a7na1:

Sequence; same for both SEQRES and ATOM records:

>d3a7na1 c.18.1.0 (A:1-227) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtarplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnv
rvlivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaq
rgvlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmla
agncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

Timeline for d3a7na1:

• d3a7na1 first appeared in SCOPe 2.03, called d3a7na_
  
• d3a7na1 was called d3a7na_ in SCOPe 2.05
  
• d3a7na1 appears in SCOPe 2.07
  
• d3a7na1 appears in the current release, SCOPe 2.08