SCOPe 2.03: Domain d2zwya1: 2zwy A:7-356

Lineage for d2zwya1 (2zwy A:7-356)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins)
   glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
   automatically mapped to Pfam PF01120

6. Protein automated matches [231482] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231744] (2 PDB entries)

8. Domain d2zwya1: 2zwy A:7-356 [231752]
   Other proteins in same PDB: d2zwya2, d2zwyb2
   automated match to d1hl9a2

Details for d2zwya1

PDB Entry: 2zwy, 2.75 Å

PDB Description: alpha-L-fucosidase

PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwya1:

Sequence; same for both SEQRES and ATOM records:

>d2zwya1 c.1.8.11 (A:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

Timeline for d2zwya1:

• d2zwya1 is new in SCOPe 2.03-stable
  
• d2zwya1 appears in SCOPe 2.04
  
• d2zwya1 appears in the current release, SCOPe 2.08