SCOPe 2.04: Domain d2zwzb1: 2zwz B:7-356

Lineage for d2zwzb1 (2zwz B:7-356)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins)
   glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
   automatically mapped to Pfam PF01120

6. Protein automated matches [231482] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries)

8. Domain d2zwzb1: 2zwz B:7-356 [231750]
   Other proteins in same PDB: d2zwza2, d2zwzb2
   automated match to d1hl9a2
   complexed with zwz

Details for d2zwzb1

PDB Entry: 2zwz, 2.36 Å

PDB Description: alpha-L-fucosidase complexed with inhibitor, Core1

PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwzb1:

Sequence; same for both SEQRES and ATOM records:

>d2zwzb1 c.1.8.11 (B:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

Timeline for d2zwzb1:

• d2zwzb1 first appeared in SCOPe 2.03
  
• d2zwzb1 appears in SCOPe 2.05
  
• d2zwzb1 appears in the current release, SCOPe 2.08