Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
Protein automated matches [227123] (7 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [231736] (1 PDB entry) |
Domain d2zvia2: 2zvi A:124-410 [231743] Other proteins in same PDB: d2zvia1, d2zvib1, d2zvic1, d2zvid1 automated match to d4nasa2 |
PDB Entry: 2zvi (more details), 2.3 Å
SCOPe Domain Sequences for d2zvia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zvia2 c.1.14.0 (A:124-410) automated matches {Bacillus subtilis [TaxId: 1423]} pgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqalggvdlikddeiffe tglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkarraaelgadallfnv faygldvmqglaedpeipvpimahpavsgaftsspfygfshalllgklnrycgadfslfp spygsvalpradalaiheecvredafnqtfavpsagihpgmvpllmrdfgidhiinaggg vhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwgk
Timeline for d2zvia2: