Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (12 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [231734] (1 PDB entry) |
Domain d2zvia1: 2zvi A:11-123 [231742] Other proteins in same PDB: d2zvia2, d2zvib2, d2zvic2, d2zvid2 automated match to d4nasa1 |
PDB Entry: 2zvi (more details), 2.3 Å
SCOPe Domain Sequences for d2zvia1:
Sequence, based on SEQRES records: (download)
>d2zvia1 d.58.9.0 (A:11-123) automated matches {Bacillus subtilis [TaxId: 1423]} sellatylltepgadtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeregta asekqavitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkral
>d2zvia1 d.58.9.0 (A:11-123) automated matches {Bacillus subtilis [TaxId: 1423]} sellatylltepdtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeraasekq avitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkral
Timeline for d2zvia1: