Lineage for d2zu6d2 (2zu6 D:246-402)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870741Protein Initiation factor 4a [52706] (2 species)
    homologous to UvrB
  7. 2870749Species Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries)
    Uniprot P60842 21-238
    4A-I
  8. 2870758Domain d2zu6d2: 2zu6 D:246-402 [231733]
    Other proteins in same PDB: d2zu6a3, d2zu6d3
    automated match to d2zu6c2
    protein/RNA complex; complexed with acy, edo

Details for d2zu6d2

PDB Entry: 2zu6 (more details), 2.8 Å

PDB Description: crystal structure of the eIF4A-PDCD4 complex
PDB Compounds: (D:) Eukaryotic initiation factor 4A-I

SCOPe Domain Sequences for d2zu6d2:

Sequence, based on SEQRES records: (download)

>d2zu6d2 c.37.1.19 (D:246-402) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd
mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihrigrggr
fgrkgvainmvteedkrtlrdietfyntsieemplnv

Sequence, based on observed residues (ATOM records): (download)

>d2zu6d2 c.37.1.19 (D:246-402) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltiqavifintrrkvdwltekmhardftvsamhgrd
vimrefrsgssvlittdllargidvqqvslvinydlptnrenyihrigrggrkgvainmv
teedkrtlrdietfyntsieemplnv

SCOPe Domain Coordinates for d2zu6d2:

Click to download the PDB-style file with coordinates for d2zu6d2.
(The format of our PDB-style files is described here.)

Timeline for d2zu6d2: