SCOPe 2.08: Domain d2zu6a2: 2zu6 A:246-401

Lineage for d2zu6a2 (2zu6 A:246-401)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Initiation factor 4a [52706] (2 species)
   homologous to UvrB

7. Species Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries)
   Uniprot P60842 21-238
   4A-I

8. Domain d2zu6a2: 2zu6 A:246-401 [231731]
   Other proteins in same PDB: d2zu6a3, d2zu6d3
   automated match to d2zu6c2
   protein/RNA complex; complexed with acy, edo

Details for d2zu6a2

PDB Entry: 2zu6, 2.8 Å

PDB Description: crystal structure of the eIF4A-PDCD4 complex

PDB Compounds: (A:) Eukaryotic initiation factor 4A-I

SCOPe Domain Sequences for d2zu6a2:

Sequence, based on SEQRES records:

>d2zu6a2 c.37.1.19 (A:246-401) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd
mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihrigrggr
fgrkgvainmvteedkrtlrdietfyntsieempln

Sequence, based on observed residues (ATOM records):

>d2zu6a2 c.37.1.19 (A:246-401) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhrd
vimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihrigrggrfgkgvai
nmvteedkrtlrdietfyntsieempln

Timeline for d2zu6a2:

• d2zu6a2 first appeared in SCOPe 2.03
  
• d2zu6a2 appears in SCOPe 2.07