Lineage for d2zu0c_ (2zu0 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366209Species Escherichia coli [TaxId:83333] [231728] (3 PDB entries)
  8. 1366213Domain d2zu0c_: 2zu0 C: [231729]
    Other proteins in same PDB: d2zu0a_, d2zu0b_
    automated match to d2d2ea_
    complexed with mes

Details for d2zu0c_

PDB Entry: 2zu0 (more details), 2.2 Å

PDB Description: Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis
PDB Compounds: (C:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d2zu0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zu0c_ c.37.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
ygwlteq

SCOPe Domain Coordinates for d2zu0c_:

Click to download the PDB-style file with coordinates for d2zu0c_.
(The format of our PDB-style files is described here.)

Timeline for d2zu0c_: