Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Escherichia coli [TaxId:83333] [231728] (3 PDB entries) |
Domain d2zu0c_: 2zu0 C: [231729] Other proteins in same PDB: d2zu0a_, d2zu0b_ automated match to d2d2ea_ complexed with mes |
PDB Entry: 2zu0 (more details), 2.2 Å
SCOPe Domain Sequences for d2zu0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zu0c_ c.37.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg ygwlteq
Timeline for d2zu0c_: