SCOPe 2.03: Domain d2zqkb2: 2zqk B:95-188

Lineage for d2zqkb2 (2zqk B:95-188)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [231724] (1 PDB entry)

8. Domain d2zqkb2: 2zqk B:95-188 [231727]
   Other proteins in same PDB: d2zqka1, d2zqkb1
   automated match to d1f00i3

Details for d2zqkb2

PDB Entry: 2zqk, 2.8 Å

PDB Description: Crystal structure of intimin-Tir68 complex

PDB Compounds: (B:) intimin

SCOPe Domain Sequences for d2zqkb2:

Sequence; same for both SEQRES and ATOM records:

>d2zqkb2 d.169.1.0 (B:95-188) automated matches {Escherichia coli [TaxId: 83334]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

Timeline for d2zqkb2:

• d2zqkb2 is new in SCOPe 2.03-stable
  
• d2zqkb2 appears in SCOPe 2.04
  
• d2zqkb2 appears in the current release, SCOPe 2.08