Lineage for d2zqkb2 (2zqk B:95-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002328Species Escherichia coli [TaxId:83334] [231724] (2 PDB entries)
  8. 3002330Domain d2zqkb2: 2zqk B:95-188 [231727]
    Other proteins in same PDB: d2zqka1, d2zqkb1
    automated match to d1f00i3

Details for d2zqkb2

PDB Entry: 2zqk (more details), 2.8 Å

PDB Description: Crystal structure of intimin-Tir68 complex
PDB Compounds: (B:) intimin

SCOPe Domain Sequences for d2zqkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqkb2 d.169.1.0 (B:95-188) automated matches {Escherichia coli [TaxId: 83334]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

SCOPe Domain Coordinates for d2zqkb2:

Click to download the PDB-style file with coordinates for d2zqkb2.
(The format of our PDB-style files is described here.)

Timeline for d2zqkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zqkb1