![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (21 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [231724] (2 PDB entries) |
![]() | Domain d2zqkb2: 2zqk B:95-188 [231727] Other proteins in same PDB: d2zqka1, d2zqkb1 automated match to d1f00i3 |
PDB Entry: 2zqk (more details), 2.8 Å
SCOPe Domain Sequences for d2zqkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqkb2 d.169.1.0 (B:95-188) automated matches {Escherichia coli [TaxId: 83334]} ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss eqrsgvsstynlitqnplpgvnvntpnvyavcve
Timeline for d2zqkb2: