Lineage for d2zqkb1 (2zqk B:5-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764897Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2764917Family b.1.14.0: automated matches [231720] (1 protein)
    not a true family
  6. 2764918Protein automated matches [231721] (3 species)
    not a true protein
  7. 2764930Species Escherichia coli [TaxId:83334] [231722] (1 PDB entry)
  8. 2764932Domain d2zqkb1: 2zqk B:5-94 [231726]
    Other proteins in same PDB: d2zqka2, d2zqkb2
    automated match to d1f00i2

Details for d2zqkb1

PDB Entry: 2zqk (more details), 2.8 Å

PDB Description: Crystal structure of intimin-Tir68 complex
PDB Compounds: (B:) intimin

SCOPe Domain Sequences for d2zqkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqkb1 b.1.14.0 (B:5-94) automated matches {Escherichia coli [TaxId: 83334]}
tffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasg
kvtlngkgsvvikatsgdkqtvsytikaps

SCOPe Domain Coordinates for d2zqkb1:

Click to download the PDB-style file with coordinates for d2zqkb1.
(The format of our PDB-style files is described here.)

Timeline for d2zqkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zqkb2