Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Streptococcus mutans [231714] (2 PDB entries) |
Domain d2zida1: 2zid A:1-463 [231718] Other proteins in same PDB: d2zida2 automated match to d4aiea1 complexed with ca |
PDB Entry: 2zid (more details), 2.2 Å
SCOPe Domain Sequences for d2zida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zida1 c.1.8.0 (A:1-463) automated matches {Streptococcus mutans} mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvd
Timeline for d2zida1: