Lineage for d2zica1 (2zic A:1-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084194Species Streptococcus mutans [231714] (2 PDB entries)
  8. 2084196Domain d2zica1: 2zic A:1-463 [231715]
    Other proteins in same PDB: d2zica2
    automated match to d4aiea1
    complexed with ca, gol, trs

Details for d2zica1

PDB Entry: 2zic (more details), 2.2 Å

PDB Description: Crystal structure of Streptococcus mutans dextran glucosidase
PDB Compounds: (A:) Dextran glucosidase

SCOPe Domain Sequences for d2zica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zica1 c.1.8.0 (A:1-463) automated matches {Streptococcus mutans}
mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgetwga
tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvd

SCOPe Domain Coordinates for d2zica1:

Click to download the PDB-style file with coordinates for d2zica1.
(The format of our PDB-style files is described here.)

Timeline for d2zica1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zica2