Lineage for d2zi8b1 (2zi8 B:1-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942975Species Mycobacterium tuberculosis [TaxId:1773] [231709] (2 PDB entries)
  8. 2942982Domain d2zi8b1: 2zi8 B:1-132 [231712]
    automated match to d2wl3b1
    complexed with fe2, sdt

Details for d2zi8b1

PDB Entry: 2zi8 (more details), 2.2 Å

PDB Description: crystal structure of the hsac extradiol dioxygenase from m. tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3, 5(10)-triene-9,17-dione (dhsa)
PDB Compounds: (B:) probable biphenyl-2,3-diol 1,2-dioxygenase bphc

SCOPe Domain Sequences for d2zi8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zi8b1 d.32.1.0 (B:1-132) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msirslgylrieatdmaawreyglkvlgmvegkgapegalylrmddfparlvvvpgehdr
lleagwecanaeglqeirnrldlegtpykeataaeladrrvdemirfadpsgnclevfhg
talehrrvvspy

SCOPe Domain Coordinates for d2zi8b1:

Click to download the PDB-style file with coordinates for d2zi8b1.
(The format of our PDB-style files is described here.)

Timeline for d2zi8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zi8b2