SCOPe 2.04: Domain d2zhya_: 2zhy A:

Lineage for d2zhya_ (2zhy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (6 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:57975] [225495] (2 PDB entries)

8. Domain d2zhya_: 2zhy A: [231707]
   automated match to d2zhyb_

Details for d2zhya_

PDB Entry: 2zhy, 1.8 Å

PDB Description: crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis

PDB Compounds: (A:) ATP:cob(I)alamin adenosyltransferase, putative

SCOPe Domain Sequences for d2zhya_:

Sequence; same for both SEQRES and ATOM records:

>d2zhya_ a.25.2.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 57975]}
dariaaigdvdelnsqigvllaeplpddvraalsaiqhdlfdlggelcipghaaitdahl
arldgwlahyngqlppleefilpggargaalahvcrtvcrraersivalgaseplnaapr
ryvnrlsdllfvlarvlnraaggadvl

Timeline for d2zhya_:

• d2zhya_ first appeared in SCOPe 2.03
  
• d2zhya_ appears in SCOPe 2.05
  
• d2zhya_ appears in the current release, SCOPe 2.08