![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
![]() | Protein automated matches [190652] (6 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:57975] [225495] (2 PDB entries) |
![]() | Domain d2zhya_: 2zhy A: [231707] automated match to d2zhyb_ |
PDB Entry: 2zhy (more details), 1.8 Å
SCOPe Domain Sequences for d2zhya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhya_ a.25.2.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 57975]} dariaaigdvdelnsqigvllaeplpddvraalsaiqhdlfdlggelcipghaaitdahl arldgwlahyngqlppleefilpggargaalahvcrtvcrraersivalgaseplnaapr ryvnrlsdllfvlarvlnraaggadvl
Timeline for d2zhya_: