SCOPe 2.07: Domain d2zgqa1: 2zgq A:0-158

Lineage for d2zgqa1 (2zgq A:0-158)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zgqa1: 2zgq A:0-158 [231702]
   Other proteins in same PDB: d2zgqa2, d2zgqb2
   automated match to d1ww4a_
   mutant

Details for d2zgqa1

PDB Entry: 2zgq, 1.9 Å

PDB Description: crystal structure of aal mutant l33a in p1 spacegroup

PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgqa1:

Sequence; same for both SEQRES and ATOM records:

>d2zgqa1 b.29.1.0 (A:0-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

Timeline for d2zgqa1:

• d2zgqa1 first appeared in SCOPe 2.03, called d2zgqa_
  
• d2zgqa1 appears in SCOPe 2.06
  
• d2zgqa1 appears in the current release, SCOPe 2.08