Lineage for d2zgqa1 (2zgq A:0-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780627Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 2780632Domain d2zgqa1: 2zgq A:0-158 [231702]
    Other proteins in same PDB: d2zgqa2, d2zgqb2
    automated match to d1ww4a_
    mutant

Details for d2zgqa1

PDB Entry: 2zgq (more details), 1.9 Å

PDB Description: crystal structure of aal mutant l33a in p1 spacegroup
PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgqa1 b.29.1.0 (A:0-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

SCOPe Domain Coordinates for d2zgqa1:

Click to download the PDB-style file with coordinates for d2zgqa1.
(The format of our PDB-style files is described here.)

Timeline for d2zgqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zgqa2