SCOPe 2.08: Domain d2zglb1: 2zgl B:0-158

Lineage for d2zglb1 (2zgl B:0-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zglb1: 2zgl B:0-158 [231696]
   Other proteins in same PDB: d2zgla2, d2zglb2
   automated match to d1ww4a_

Details for d2zglb1

PDB Entry: 2zgl, 1.9 Å

PDB Description: Crystal structure of recombinant Agrocybe aegerita (rAAL)

PDB Compounds: (B:) Anti-tumor lectin

SCOPe Domain Sequences for d2zglb1:

Sequence; same for both SEQRES and ATOM records:

>d2zglb1 b.29.1.0 (B:0-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

Timeline for d2zglb1:

• d2zglb1 first appeared in SCOPe 2.03, called d2zglb_
  
• d2zglb1 appears in SCOPe 2.07