| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (130 species) not a true protein |
| Species Japanese encephalitis virus [TaxId:11072] [231691] (1 PDB entry) |
| Domain d2z83a2: 2z83 A:484-618 [231693] automated match to d2bhra1 |
PDB Entry: 2z83 (more details), 1.8 Å
SCOPe Domain Sequences for d2z83a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z83a2 c.37.1.0 (A:484-618) automated matches {Japanese encephalitis virus [TaxId: 11072]}
snlahwteakimldnihmpnglvaqlygperekaftmdgeyrlrgeekknflellrtadl
pvwlaykvasngiqytdrkwcfdgprtnailednieveivtrmgerkilkprwldarvya
dhqalkwfkdfaagk
Timeline for d2z83a2: