SCOPe 2.05: Domain d2z83a2: 2z83 A:484-618

Lineage for d2z83a2 (2z83 A:484-618)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Japanese encephalitis virus [TaxId:11072] [231691] (1 PDB entry)

8. Domain d2z83a2: 2z83 A:484-618 [231693]
   automated match to d2bhra1

Details for d2z83a2

PDB Entry: 2z83, 1.8 Å

PDB Description: Crystal Structure of Catalytic Domain of Japanese Encephalitis Virus NS3 Helicase/Nucleoside Triphosphatase at a Resolution 1.8

PDB Compounds: (A:) Helicase/Nucleoside Triphosphatase

SCOPe Domain Sequences for d2z83a2:

Sequence; same for both SEQRES and ATOM records:

>d2z83a2 c.37.1.0 (A:484-618) automated matches {Japanese encephalitis virus [TaxId: 11072]}
snlahwteakimldnihmpnglvaqlygperekaftmdgeyrlrgeekknflellrtadl
pvwlaykvasngiqytdrkwcfdgprtnailednieveivtrmgerkilkprwldarvya
dhqalkwfkdfaagk

Timeline for d2z83a2:

• d2z83a2 first appeared in SCOPe 2.03
  
• d2z83a2 appears in SCOPe 2.04
  
• d2z83a2 appears in SCOPe 2.06
  
• d2z83a2 appears in the current release, SCOPe 2.08