Lineage for d2z83a1 (2z83 A:181-483)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114413Species Japanese encephalitis virus [TaxId:11072] [231691] (1 PDB entry)
  8. 2114414Domain d2z83a1: 2z83 A:181-483 [231692]
    automated match to d2bhra2

Details for d2z83a1

PDB Entry: 2z83 (more details), 1.8 Å

PDB Description: Crystal Structure of Catalytic Domain of Japanese Encephalitis Virus NS3 Helicase/Nucleoside Triphosphatase at a Resolution 1.8
PDB Compounds: (A:) Helicase/Nucleoside Triphosphatase

SCOPe Domain Sequences for d2z83a1:

Sequence, based on SEQRES records: (download)

>d2z83a1 c.37.1.0 (A:181-483) automated matches {Japanese encephalitis virus [TaxId: 11072]}
pnmlrkrqmtvldlhpgsgktrkilpqiikdaiqqrlrtavlaptrvvaaemaealrglp
vryqtsavqrehqgneivdvmchatlthrlmspnrvpnynlfvmdeahftdpasiaargy
iatkvelgeaaaifmtatppgttdpfpdsnapihdlqdeipdrawssgyewiteyagktv
wfvasvkmgneiamclqragkkviqlnrksydteypkckngdwdfvittdisemganfga
srvidcrksvkptileegegrvilgnpspitsasaaqrrgrvgrnpnqvgdeyhyggats
edd

Sequence, based on observed residues (ATOM records): (download)

>d2z83a1 c.37.1.0 (A:181-483) automated matches {Japanese encephalitis virus [TaxId: 11072]}
pnmlrkrqmtvldlhpgsgktrkilpqiikdaiqqrlrtavlaptrvvaaemaealrglp
vryqtgneivdvmchatlthrlmspnvpnynlfvmdeahftdpasiaargyiatkvelge
aaaifmtatppgttdpfpdsnapihdlqdeipdrawssgyewiteyagktvwfvasvkmg
neiamclqragkkviqlnrksydteypkckngdwdfvittdisanfgasrvidcrksvkp
tileegegrvilgnpspitsasaaqrrgrvgrnpnqvgdeyhyggatsedd

SCOPe Domain Coordinates for d2z83a1:

Click to download the PDB-style file with coordinates for d2z83a1.
(The format of our PDB-style files is described here.)

Timeline for d2z83a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z83a2