Lineage for d2z7eb_ (2z7e B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446741Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1446742Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1446784Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 1446785Protein automated matches [190942] (3 species)
    not a true protein
  7. 1446786Species Aquifex aeolicus [TaxId:63363] [225504] (1 PDB entry)
  8. 1446788Domain d2z7eb_: 2z7e B: [231690]
    automated match to d2z7ea_
    complexed with fes, so4

Details for d2z7eb_

PDB Entry: 2z7e (more details), 2.3 Å

PDB Description: crystal structure of aquifex aeolicus iscu with bound [2fe-2s] cluster
PDB Compounds: (B:) NifU-like protein

SCOPe Domain Sequences for d2z7eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7eb_ d.224.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
feynekvldhflnprnvgvledangvgqcgnpacgaamlftikvnpendviedvrfktfg
cgsaiavssmltemvkgkpiqyalnltykdifeelgglppqkihctnlgletlhvaikdy
lmkqgrveeaskipdcyeee

SCOPe Domain Coordinates for d2z7eb_:

Click to download the PDB-style file with coordinates for d2z7eb_.
(The format of our PDB-style files is described here.)

Timeline for d2z7eb_: