Lineage for d2z43a_ (2z43 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112413Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2112469Species Sulfolobus solfataricus [TaxId:273057] [225378] (1 PDB entry)
  8. 2112470Domain d2z43a_: 2z43 A: [231689]
    Other proteins in same PDB: d2z43b1, d2z43c1
    automated match to d2z43b2

Details for d2z43a_

PDB Entry: 2z43 (more details), 1.93 Å

PDB Description: Structure of a twinned crystal of RadA
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2z43a_:

Sequence, based on SEQRES records: (download)

>d2z43a_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
rfktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnv
qlppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaiv
ddlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiav
iitnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvvdaphlpegevv
falteegirdae

Sequence, based on observed residues (ATOM records): (download)

>d2z43a_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
rfktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnv
qlppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaiv
ddlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiav
iitnqvgiriqlkksrgnrriarvvdaphlpegevvfalteegirdae

SCOPe Domain Coordinates for d2z43a_:

Click to download the PDB-style file with coordinates for d2z43a_.
(The format of our PDB-style files is described here.)

Timeline for d2z43a_: