SCOPe 2.05: Domain d2z0oa2: 2z0o A:274-372

Lineage for d2z0oa2 (2z0o A:274-372)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d2z0oa2: 2z0o A:274-372 [231688]
   Other proteins in same PDB: d2z0oa1
   automated match to d2elba2

Details for d2z0oa2

PDB Entry: 2z0o, 2.58 Å

PDB Description: crystal structure of appl1-bar-ph domain

PDB Compounds: (A:) DCC-interacting protein 13-alpha

SCOPe Domain Sequences for d2z0oa2:

Sequence, based on SEQRES records:

>d2z0oa2 b.55.1.0 (A:274-372) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinn

Sequence, based on observed residues (ATOM records):

>d2z0oa2 b.55.1.0 (A:274-372) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnardrqfyftqggnlmsqargdvagglamdidncsvmavdcedrrycfq
itsssilqaeskkdheewictinn

Timeline for d2z0oa2:

• d2z0oa2 first appeared in SCOPe 2.03
  
• d2z0oa2 appears in SCOPe 2.04
  
• d2z0oa2 appears in SCOPe 2.06
  
• d2z0oa2 appears in the current release, SCOPe 2.08