Lineage for d2yvya2 (2yvy A:132-252)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409742Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1409743Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1409744Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1409866Protein automated matches [190627] (7 species)
    not a true protein
  7. 1409898Species Thermus thermophilus [TaxId:300852] [231686] (1 PDB entry)
  8. 1409899Domain d2yvya2: 2yvy A:132-252 [231687]
    Other proteins in same PDB: d2yvya1
    automated match to d2yvxa2
    complexed with mg

Details for d2yvya2

PDB Entry: 2yvy (more details), 2.3 Å

PDB Description: Crystal structure of magnesium transporter MgtE cytosolic domain, Mg2+ bound form
PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2yvya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvya2 d.37.1.1 (A:132-252) automated matches {Thermus thermophilus [TaxId: 300852]}
deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv
adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv
l

SCOPe Domain Coordinates for d2yvya2:

Click to download the PDB-style file with coordinates for d2yvya2.
(The format of our PDB-style files is described here.)

Timeline for d2yvya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yvya1