Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [231686] (1 PDB entry) |
Domain d2yvya2: 2yvy A:132-252 [231687] Other proteins in same PDB: d2yvya1 automated match to d2yvxa2 complexed with mg |
PDB Entry: 2yvy (more details), 2.3 Å
SCOPe Domain Sequences for d2yvya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvya2 d.37.1.1 (A:132-252) automated matches {Thermus thermophilus [TaxId: 300852]} deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv l
Timeline for d2yvya2: