SCOPe 2.08: Domain d2ywmc2: 2ywm C:122-228

Lineage for d2ywmc2 (2ywm C:122-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188265] (3 PDB entries)

8. Domain d2ywmc2: 2ywm C:122-228 [231684]
   automated match to d2aytb2

Details for d2ywmc2

PDB Entry: 2ywm, 2.3 Å

PDB Description: crystal structure of glutaredoxin-like protein from aquifex aeolicus

PDB Compounds: (C:) glutaredoxin-like protein

SCOPe Domain Sequences for d2ywmc2:

Sequence; same for both SEQRES and ATOM records:

>d2ywmc2 c.47.1.0 (C:122-228) automated matches {Aquifex aeolicus [TaxId: 224324]}
qlsektlellqvvdipieiwvfvttscgycpsaavmawdfalandyitskvidasenqdl
aeqfqvvgvpkivinkgvaefvgaqpenaflgyimavyeklkrekeq

Timeline for d2ywmc2:

• d2ywmc2 first appeared in SCOPe 2.03
  
• d2ywmc2 appears in SCOPe 2.07