SCOPe 2.08: Domain d2yvya1: 2yvy A:5-131

Lineage for d2yvya1 (2yvy A:5-131)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families)
   made of short helices; approximately 2.5 helices per turn of superhelix
   automatically mapped to Pfam PF03448

5. Family a.118.26.0: automated matches [231669] (1 protein)
   not a true family

6. Protein automated matches [231679] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [231681] (1 PDB entry)

8. Domain d2yvya1: 2yvy A:5-131 [231682]
   Other proteins in same PDB: d2yvya2
   automated match to d2yvxa1
   complexed with mg

Details for d2yvya1

PDB Entry: 2yvy, 2.3 Å

PDB Description: Crystal structure of magnesium transporter MgtE cytosolic domain, Mg2+ bound form

PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2yvya1:

Sequence; same for both SEQRES and ATOM records:

>d2yvya1 a.118.26.0 (A:5-131) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lavslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshl
speeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeve
alaryee

Timeline for d2yvya1:

• d2yvya1 first appeared in SCOPe 2.03
  
• d2yvya1 appears in SCOPe 2.07