Lineage for d1djgb2 (1djg B:626-756)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 56369Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 56370Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 56371Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins)
  6. 56393Protein PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain [49564] (1 species)
  7. 56394Species Rat (Rattus norvegicus) [TaxId:10116] [49565] (10 PDB entries)
  8. 56404Domain d1djgb2: 1djg B:626-756 [23168]
    Other proteins in same PDB: d1djga1, d1djga3, d1djgb1, d1djgb3

Details for d1djgb2

PDB Entry: 1djg (more details), 2.6 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with lanthanum

SCOP Domain Sequences for d1djgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djgb2 b.7.1.1 (B:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus)}
wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd
mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps
atlfvkisiqd

SCOP Domain Coordinates for d1djgb2:

Click to download the PDB-style file with coordinates for d1djgb2.
(The format of our PDB-style files is described here.)

Timeline for d1djgb2: