![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain [49564] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49565] (11 PDB entries) |
![]() | Domain d1djgb2: 1djg B:626-756 [23168] Other proteins in same PDB: d1djga1, d1djga3, d1djgb1, d1djgb3 complexed with act, la |
PDB Entry: 1djg (more details), 2.6 Å
SCOPe Domain Sequences for d1djgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djgb2 b.7.1.1 (B:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps atlfvkisiqd
Timeline for d1djgb2: