Lineage for d2z0oa1 (2z0o A:1-273)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015824Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2015825Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2015826Family a.238.1.1: BAR domain [103658] (4 protein domains)
    sensor of membrane curvature
  6. 2015843Protein automated matches [190594] (1 species)
    not a true protein
  7. 2015844Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries)
  8. 2015849Domain d2z0oa1: 2z0o A:1-273 [231678]
    Other proteins in same PDB: d2z0oa2
    automated match to d2elba1

Details for d2z0oa1

PDB Entry: 2z0o (more details), 2.58 Å

PDB Description: crystal structure of appl1-bar-ph domain
PDB Compounds: (A:) DCC-interacting protein 13-alpha

SCOPe Domain Sequences for d2z0oa1:

Sequence, based on SEQRES records: (download)

>d2z0oa1 a.238.1.1 (A:1-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
tskllkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfke
rdlkeiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmh
yfcalntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrrem
dsdietmqqtiedlevasdplyvpdpdptkfpv

Sequence, based on observed residues (ATOM records): (download)

>d2z0oa1 a.238.1.1 (A:1-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
tskllkeyekqrfpldevmsstlqqfskvidelsschavlstqladammfpitqfkerdl
keiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfc
alntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsd
ietmqqtiedlevasdplyvpdpdptkfpv

SCOPe Domain Coordinates for d2z0oa1:

Click to download the PDB-style file with coordinates for d2z0oa1.
(The format of our PDB-style files is described here.)

Timeline for d2z0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z0oa2