Lineage for d2yynb_ (2yyn B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708159Domain d2yynb_: 2yyn B: [231674]
    automated match to d3uv2a_

Details for d2yynb_

PDB Entry: 2yyn (more details), 2.5 Å

PDB Description: crystal structure of human bromodomain protein
PDB Compounds: (B:) Transcription intermediary factor 1-alpha

SCOPe Domain Sequences for d2yynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yynb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kltpidkrkcerlllflychemslafqdpvpltvpdyykiiknpmdlstikkrlqedysm
yskpedfvadfrlifqncaefnepdsevanagiklenyfeellknlypekrfpk

SCOPe Domain Coordinates for d2yynb_:

Click to download the PDB-style file with coordinates for d2yynb_.
(The format of our PDB-style files is described here.)

Timeline for d2yynb_: