Lineage for d2ywmb1 (2ywm B:1-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879051Species Aquifex aeolicus [TaxId:224324] [188265] (3 PDB entries)
  8. 2879070Domain d2ywmb1: 2ywm B:1-121 [231672]
    automated match to d2aytb1

Details for d2ywmb1

PDB Entry: 2ywm (more details), 2.3 Å

PDB Description: crystal structure of glutaredoxin-like protein from aquifex aeolicus
PDB Compounds: (B:) glutaredoxin-like protein

SCOPe Domain Sequences for d2ywmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywmb1 c.47.1.0 (B:1-121) automated matches {Aquifex aeolicus [TaxId: 224324]}
mllnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdki
kldiyspfthkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrk
p

SCOPe Domain Coordinates for d2ywmb1:

Click to download the PDB-style file with coordinates for d2ywmb1.
(The format of our PDB-style files is described here.)

Timeline for d2ywmb1: