Lineage for d2yooc_ (2yoo C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2331949Species Mycobacterium smegmatis [TaxId:246196] [231662] (7 PDB entries)
  8. 2331952Domain d2yooc_: 2yoo C: [231663]
    automated match to d2xkra_
    complexed with hem, k2b, mg

Details for d2yooc_

PDB Entry: 2yoo (more details), 1.69 Å

PDB Description: cholest-4-en-3-one bound structure of cyp142 from mycobacterium smegmatis
PDB Compounds: (C:) p450 heme-thiolate protein

SCOPe Domain Sequences for d2yooc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yooc_ a.104.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
trpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfsst
ggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerge
cdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaay
teftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsgg
teqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelragekim
lmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrlp
dlrladdapvplrpanfvsgpesmpvvftpsapvl

SCOPe Domain Coordinates for d2yooc_:

Click to download the PDB-style file with coordinates for d2yooc_.
(The format of our PDB-style files is described here.)

Timeline for d2yooc_: