Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189951] (3 PDB entries) |
Domain d2yoba_: 2yob A: [231661] automated match to d2yobb_ complexed with btb, gol, plp, so4 |
PDB Entry: 2yob (more details), 1.9 Å
SCOPe Domain Sequences for d2yoba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yoba_ c.67.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikeg iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarv hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvd svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq alglqlfvkdpalrlptvttvavpagydwrdivsyvmdhfdieimgglgpstgkvlrigl lgcnatrenvdrvtealraalvaqa
Timeline for d2yoba_: