Lineage for d2yoba_ (2yob A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380298Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1380484Protein automated matches [190399] (4 species)
    not a true protein
  7. 1380485Species Human (Homo sapiens) [TaxId:9606] [189951] (3 PDB entries)
  8. 1380486Domain d2yoba_: 2yob A: [231661]
    automated match to d2yobb_
    complexed with btb, gol, plp, so4

Details for d2yoba_

PDB Entry: 2yob (more details), 1.9 Å

PDB Description: High resolution AGXT_M structure
PDB Compounds: (A:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d2yoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yoba_ c.67.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikeg
iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarv
hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvd
svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld
ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq
alglqlfvkdpalrlptvttvavpagydwrdivsyvmdhfdieimgglgpstgkvlrigl
lgcnatrenvdrvtealraalvaqa

SCOPe Domain Coordinates for d2yoba_:

Click to download the PDB-style file with coordinates for d2yoba_.
(The format of our PDB-style files is described here.)

Timeline for d2yoba_: