Lineage for d2ynbb_ (2ynb B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1320532Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1320533Protein automated matches [190438] (15 species)
    not a true protein
  7. 1320647Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (2 PDB entries)
  8. 1320651Domain d2ynbb_: 2ynb B: [231660]
    automated match to d2ynaa_
    complexed with g85, ni

Details for d2ynbb_

PDB Entry: 2ynb (more details), 1.96 Å

PDB Description: crystal structure of the main protease of coronavirus hku4 in complex with a michael acceptor sg85
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2ynbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynbb_ b.47.1.0 (B:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]}
sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis
ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac
yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf
dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn
qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv
mg

SCOPe Domain Coordinates for d2ynbb_:

Click to download the PDB-style file with coordinates for d2ynbb_.
(The format of our PDB-style files is described here.)

Timeline for d2ynbb_: