SCOPe 2.07: Domain d2y8wa2: 2y8w A:88-211

Lineage for d2y8wa2 (2y8w A:88-211)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families)

5. Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins)
   duplication: contains two subdomains of this fold

6. Protein automated matches [231635] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [231636] (3 PDB entries)

8. Domain d2y8wa2: 2y8w A:88-211 [231655]
   Other proteins in same PDB: d2y8wa1, d2y8wa3
   automated match to d1wj9a2
   protein/RNA complex

Details for d2y8wa2

PDB Entry: 2y8w, 1.8 Å

PDB Description: structure of crispr endoribonuclease cse3 bound to 20 nt rna

PDB Compounds: (A:) cse3

SCOPe Domain Sequences for d2y8wa2:

Sequence; same for both SEQRES and ATOM records:

>d2y8wa2 d.58.53.1 (A:88-211) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

Timeline for d2y8wa2:

• d2y8wa2 first appeared in SCOPe 2.03
  
• d2y8wa2 appears in SCOPe 2.06
  
• d2y8wa2 appears in the current release, SCOPe 2.08