Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Clostridium symbiosum [TaxId:1512] [231640] (1 PDB entry) |
Domain d2yfhc2: 2yfh C:196-448 [231653] Other proteins in same PDB: d2yfha1, d2yfhb1, d2yfhc1, d2yfhd1, d2yfhe1, d2yfhf1 automated match to d1bgva1 |
PDB Entry: 2yfh (more details), 2.7 Å
SCOPe Domain Sequences for d2yfhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfhc2 c.2.1.0 (C:196-448) automated matches {Clostridium symbiosum [TaxId: 1512]} karsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga rvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvylegqqpwslpvd ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg vatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryglgynlvaganivgfq kiadammaqgiaw
Timeline for d2yfhc2: