Lineage for d2y9hc2 (2y9h C:88-211)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1418429Superfamily d.58.53: CRISPR-associated protein [117987] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 1418430Family d.58.53.1: CRISPR-associated protein [117988] (2 proteins)
  6. 1418435Protein automated matches [231635] (1 species)
    not a true protein
  7. 1418436Species Thermus thermophilus [TaxId:300852] [231636] (3 PDB entries)
  8. 1418440Domain d2y9hc2: 2y9h C:88-211 [231650]
    Other proteins in same PDB: d2y9ha1, d2y9hc1, d2y9he1, d2y9hg1, d2y9hi1, d2y9hk1, d2y9hm1, d2y9ho1
    automated match to d1wj9a2
    protein/RNA complex

Details for d2y9hc2

PDB Entry: 2y9h (more details), 2.5 Å

PDB Description: structure a of crispr endoribonuclease cse3 bound to 19 nt rna
PDB Compounds: (C:) cse3

SCOPe Domain Sequences for d2y9hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9hc2 d.58.53.1 (C:88-211) automated matches {Thermus thermophilus [TaxId: 300852]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

SCOPe Domain Coordinates for d2y9hc2:

Click to download the PDB-style file with coordinates for d2y9hc2.
(The format of our PDB-style files is described here.)

Timeline for d2y9hc2: