Lineage for d2y9ha2 (2y9h A:88-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955800Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) (S)
  5. 2955801Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins)
    duplication: contains two subdomains of this fold
  6. 2955806Protein automated matches [231635] (1 species)
    not a true protein
  7. 2955807Species Thermus thermophilus HB8 [TaxId:300852] [231636] (3 PDB entries)
  8. 2955810Domain d2y9ha2: 2y9h A:88-211 [231639]
    Other proteins in same PDB: d2y9ha1, d2y9ha3, d2y9hc1, d2y9he1, d2y9he3, d2y9hg1, d2y9hg3, d2y9hi1, d2y9hi3, d2y9hk1, d2y9hk3, d2y9hm1, d2y9hm3, d2y9ho1, d2y9ho3
    automated match to d1wj9a2
    protein/RNA complex

Details for d2y9ha2

PDB Entry: 2y9h (more details), 2.5 Å

PDB Description: structure a of crispr endoribonuclease cse3 bound to 19 nt rna
PDB Compounds: (A:) cse3

SCOPe Domain Sequences for d2y9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9ha2 d.58.53.1 (A:88-211) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

SCOPe Domain Coordinates for d2y9ha2:

Click to download the PDB-style file with coordinates for d2y9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2y9ha2: