| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) ![]() |
| Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins) duplication: contains two subdomains of this fold |
| Protein automated matches [231635] (1 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [231636] (3 PDB entries) |
| Domain d2y9ha2: 2y9h A:88-211 [231639] Other proteins in same PDB: d2y9ha1, d2y9ha3, d2y9hc1, d2y9he1, d2y9he3, d2y9hg1, d2y9hg3, d2y9hi1, d2y9hi3, d2y9hk1, d2y9hk3, d2y9hm1, d2y9hm3, d2y9ho1, d2y9ho3 automated match to d1wj9a2 protein/RNA complex |
PDB Entry: 2y9h (more details), 2.5 Å
SCOPe Domain Sequences for d2y9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y9ha2 d.58.53.1 (A:88-211) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap
Timeline for d2y9ha2: