Lineage for d2y8wa1 (2y8w A:1-87)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562638Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families) (S)
  5. 2562666Family d.58.53.0: automated matches [231597] (1 protein)
    not a true family
  6. 2562667Protein automated matches [231598] (1 species)
    not a true protein
  7. 2562668Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries)
  8. 2562670Domain d2y8wa1: 2y8w A:1-87 [231633]
    Other proteins in same PDB: d2y8wa2, d2y8wa3
    automated match to d1wj9a1
    protein/RNA complex

Details for d2y8wa1

PDB Entry: 2y8w (more details), 1.8 Å

PDB Description: structure of crispr endoribonuclease cse3 bound to 20 nt rna
PDB Compounds: (A:) cse3

SCOPe Domain Sequences for d2y8wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y8wa1 d.58.53.0 (A:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

SCOPe Domain Coordinates for d2y8wa1:

Click to download the PDB-style file with coordinates for d2y8wa1.
(The format of our PDB-style files is described here.)

Timeline for d2y8wa1: