| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) ![]() |
| Family d.58.53.0: automated matches [231597] (1 protein) not a true family |
| Protein automated matches [231598] (4 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries) |
| Domain d2y8wa1: 2y8w A:1-87 [231633] Other proteins in same PDB: d2y8wa2, d2y8wa3 automated match to d1wj9a1 protein/RNA complex |
PDB Entry: 2y8w (more details), 1.8 Å
SCOPe Domain Sequences for d2y8wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y8wa1 d.58.53.0 (A:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp
Timeline for d2y8wa1: