SCOPe 2.08: Domain d1djha2: 1djh A:626-756

Lineage for d1djha2 (1djh A:626-756)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain [49564] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49565] (11 PDB entries)

8. Domain d1djha2: 1djh A:626-756 [23163]
   Other proteins in same PDB: d1djha1, d1djha3, d1djhb1, d1djhb3
   complexed with act, ba

Details for d1djha2

PDB Entry: 1djh, 2.5 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with barium

PDB Compounds: (A:) phosphoinositide-specific phospholipase c, isozyme delta1

SCOPe Domain Sequences for d1djha2:

Sequence; same for both SEQRES and ATOM records:

>d1djha2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd
mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps
atlfvkisiqd

Timeline for d1djha2:

• d1djha2 first appeared (with stable ids) in SCOP 1.55
  
• d1djha2 appears in SCOPe 2.07