Lineage for d1djha2 (1djh A:626-756)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772902Protein PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain [49564] (1 species)
  7. 2772903Species Norway rat (Rattus norvegicus) [TaxId:10116] [49565] (11 PDB entries)
  8. 2772910Domain d1djha2: 1djh A:626-756 [23163]
    Other proteins in same PDB: d1djha1, d1djha3, d1djhb1, d1djhb3
    complexed with act, ba

Details for d1djha2

PDB Entry: 1djh (more details), 2.5 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with barium
PDB Compounds: (A:) phosphoinositide-specific phospholipase c, isozyme delta1

SCOPe Domain Sequences for d1djha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djha2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd
mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps
atlfvkisiqd

SCOPe Domain Coordinates for d1djha2:

Click to download the PDB-style file with coordinates for d1djha2.
(The format of our PDB-style files is described here.)

Timeline for d1djha2: