Lineage for d2yaca_ (2yac A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436481Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)
  8. 1436716Domain d2yaca_: 2yac A: [231608]
    automated match to d2rkua_
    complexed with 937, tla, zn

Details for d2yaca_

PDB Entry: 2yac (more details), 2.2 Å

PDB Description: crystal structure of polo-like kinase 1 in complex with nms-p937
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d2yaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yaca_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqrekm
smeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyylr
qivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkktlcgtpnyi
apevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinpva
asliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsiap

SCOPe Domain Coordinates for d2yaca_:

Click to download the PDB-style file with coordinates for d2yaca_.
(The format of our PDB-style files is described here.)

Timeline for d2yaca_: