| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families) ![]() |
| Family d.58.53.0: automated matches [231597] (1 protein) not a true family |
| Protein automated matches [231598] (1 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries) |
| Domain d2y9hc1: 2y9h C:1-87 [231604] Other proteins in same PDB: d2y9ha2, d2y9ha3, d2y9hc2, d2y9he2, d2y9he3, d2y9hg2, d2y9hg3, d2y9hi2, d2y9hi3, d2y9hk2, d2y9hk3, d2y9hm2, d2y9hm3, d2y9ho2, d2y9ho3 automated match to d1wj9a1 protein/RNA complex |
PDB Entry: 2y9h (more details), 2.5 Å
SCOPe Domain Sequences for d2y9hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y9hc1 d.58.53.0 (C:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp
Timeline for d2y9hc1: