![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families) ![]() |
![]() | Family d.58.53.0: automated matches [231597] (1 protein) not a true family |
![]() | Protein automated matches [231598] (1 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries) |
![]() | Domain d2y9hg1: 2y9h G:1-87 [231601] Other proteins in same PDB: d2y9ha2, d2y9ha3, d2y9hc2, d2y9he2, d2y9he3, d2y9hg2, d2y9hg3, d2y9hi2, d2y9hi3, d2y9hk2, d2y9hk3, d2y9hm2, d2y9hm3, d2y9ho2, d2y9ho3 automated match to d1wj9a1 protein/RNA complex |
PDB Entry: 2y9h (more details), 2.5 Å
SCOPe Domain Sequences for d2y9hg1:
Sequence, based on SEQRES records: (download)
>d2y9hg1 d.58.53.0 (G:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl vqtltepdwsvldegyaqvfppkpfhp
>d2y9hg1 d.58.53.0 (G:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepppvvlvqtlt epdwsvldegyaqvfppkpfhp
Timeline for d2y9hg1: