SCOPe 2.03: Domain d2y9hg1: 2y9h G:0-87

Lineage for d2y9hg1 (2y9h G:0-87)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: CRISPR-associated protein [117987] (2 families)
   duplication: contains two subdomains of this fold

5. Family d.58.53.0: automated matches [231597] (1 protein)
   not a true family

6. Protein automated matches [231598] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [231599] (3 PDB entries)

8. Domain d2y9hg1: 2y9h G:0-87 [231601]
   Other proteins in same PDB: d2y9ha2, d2y9hc2, d2y9he2, d2y9hg2, d2y9hi2, d2y9hk2, d2y9hm2, d2y9ho2
   automated match to d1wj9a1
   protein/RNA complex

Details for d2y9hg1

PDB Entry: 2y9h, 2.5 Å

PDB Description: structure a of crispr endoribonuclease cse3 bound to 19 nt rna

PDB Compounds: (G:) cse3

SCOPe Domain Sequences for d2y9hg1:

Sequence, based on SEQRES records:

>d2y9hg1 d.58.53.0 (G:0-87) automated matches {Thermus thermophilus [TaxId: 300852]}
amwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvv
lvqtltepdwsvldegyaqvfppkpfhp

Sequence, based on observed residues (ATOM records):

>d2y9hg1 d.58.53.0 (G:0-87) automated matches {Thermus thermophilus [TaxId: 300852]}
amwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepppvvlvqtl
tepdwsvldegyaqvfppkpfhp

Timeline for d2y9hg1:

• d2y9hg1 is new in SCOPe 2.03-stable
  
• d2y9hg1 appears in SCOPe 2.04
  
• d2y9hg1 appears in the current release, SCOPe 2.08