Lineage for d2y9he1 (2y9h E:1-87)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562638Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families) (S)
  5. 2562666Family d.58.53.0: automated matches [231597] (1 protein)
    not a true family
  6. 2562667Protein automated matches [231598] (1 species)
    not a true protein
  7. 2562668Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries)
  8. 2562673Domain d2y9he1: 2y9h E:1-87 [231600]
    Other proteins in same PDB: d2y9ha2, d2y9ha3, d2y9hc2, d2y9he2, d2y9he3, d2y9hg2, d2y9hg3, d2y9hi2, d2y9hi3, d2y9hk2, d2y9hk3, d2y9hm2, d2y9hm3, d2y9ho2, d2y9ho3
    automated match to d1wj9a1
    protein/RNA complex

Details for d2y9he1

PDB Entry: 2y9h (more details), 2.5 Å

PDB Description: structure a of crispr endoribonuclease cse3 bound to 19 nt rna
PDB Compounds: (E:) cse3

SCOPe Domain Sequences for d2y9he1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9he1 d.58.53.0 (E:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

SCOPe Domain Coordinates for d2y9he1:

Click to download the PDB-style file with coordinates for d2y9he1.
(The format of our PDB-style files is described here.)

Timeline for d2y9he1: